SARS-CoV-2 (COVID-19) Nucleocapsid protein, His-Tag, E. coli

Catalog Number: TRZ-P2020-010_500
Article Name: SARS-CoV-2 (COVID-19) Nucleocapsid protein, His-Tag, E. coli
Biozol Catalog Number: TRZ-P2020-010_500
Supplier Catalog Number: P2020-010_500
Alternative Catalog Number: TRZ-P2020-010_500
Manufacturer: trenzyme
Host: E. coli
Category: Biochemikalien
Application: ELISA, WB
Species Reactivity: Virus
Alternative Names: coronavirus NP Protein, 2019-nCoV, coronavirus Nucleocapsid Protein, coronavirus Nucleoprotein Protein, cov np Protein, ncov NP Protein, N Protein, NCP-CoV Nucleocapsid Protein, novel coronavirus NP Protein, novel coronavirus Nucleocapsid Protein, novel coronavirus Nucleoprotein Protein, np Protein, nucleocapsid Protein, Nucleoprotein Protein, covid-19, sars-cov-2
Beneath its envelope membrane, the new coronavirus SARS-CoV-2 consists of a icosaedric nucleocapsid that contains its genectic information in form of positive sensed single-stranded RNA. The RNA is contained in a nucleoprotein complex, consisting of the SARS-CoV-2 (COVID-19) Nucleocapsid protein. This phosphoprotein is necessary to keep the capsid in its helical symmetry and aids with packaging into the viral capsid by acting as a molecular RNA chaperone. Together with the matrix (M) protein, the N-protein is one of the most abundant proteins in the viral particle, it is important for viral replication and is also known for modulating cellular signalling. It is highly immunogenic and its sequence is very conserved, therefore it is an attractive target for diagnostic purposes.
Molecular Weight: 50,0 kDa
UniProt: P0DTC9
Buffer: PBS
Purity: > 85% as determined by SDS-PAGE
Form: liquid
Sequence: MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWFTALTQHG KEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMKDLSPRWYFYYLGTGPEAG LPYGANKDGIIWVATEGALNTPKDHIGTRNPANNAAIVLQLPQGTTLPKGFYAEGSRGGS QASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQLESKMSGKGQQ QQGQTVTKKSA
Formula: pH 7,4
SDS-Page of Nucleocapsid protein His-Tag
Structural model of Nucleocapsid protein His-Tag
Histogram of Nucleocapsid protein His-Tag