human ACE2 Protein (ECD, processed) - tag-free, lyophilized formulation, Human

Catalog Number: TRZ-P2020-024_100
Article Name: human ACE2 Protein (ECD, processed) - tag-free, lyophilized formulation, Human
Biozol Catalog Number: TRZ-P2020-024_100
Supplier Catalog Number: P2020-024_100
Alternative Catalog Number: TRZ-P2020-024_100
Manufacturer: trenzyme
Host: Human
Category: Biochemikalien
Application: ELISA, FA, WB
Species Reactivity: Human
Alternative Names: hACE2, ACEH, human angiotensin-converting enzyme 2, ACE-related carboxypeptidase, Angiotensin-converting enzyme homolog, Metalloprotease MPROT15
The human Angiotensin-Converting Enzyme 2 (hACE2) is a type I transmembrane metallocarboxypeptidase with homology to ACE, a regulator in the Renin-Angiotensin system (RAS) and long-known as a target for the treatment of hypertension. hACE2 is highly expr
Molecular Weight: 80,0 kDa
UniProt: Q9BYF1
Buffer: 50 mM Tris, 250 mM NaCl
Purity: > 80% as determined by SDS-PAGE. If maximum activity is needed, we recommend ordering our protein as liquid formulation (P2020-016)
Form: lyophilized
Sequence: MTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQST LAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNP QECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLYEEYVVLKNEMARANHYED YGDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLMNAYPSYISP IGCLPAHLLG
Formula: pH 8,0