SARS-CoV-2 (COVID-19) S protein, GFP/His-Tag, stabilized trimer

Product Overview

• Article Name: SARS-CoV-2 (COVID-19) S protein, GFP/His-Tag, stabilized trimer
• Biozol Catalog Number: TRZ-P2020-030_100
• Supplier Catalog Number: P2020-030_100
• Alternative Catalog Number: TRZ-P2020-030_100
• Manufacturer: trenzyme
• Category: Biochemikalien
• Application: ELISA, FA, WB
• Species Reactivity: Virus
• Alternative Names: SARS-CoV-2, coronavirus, SARS-CoV-2 spike protein, S glycoprotein, spike glycoprotein, 2019-nCoV, COVID-2019, COVID-19, covid-19, sars-cov-2

Product Description

The SARS-CoV-2 spike is presented as a trimeric structure on the surface of the virus. It consists of three identical transmembrane proteins, called spike proteins, each containing two subunits: the S1 and the S2 subunit. The S1 is necessary for the reco

Product Properties

• Molecular Weight: 168,1 kDa per monomer
• UniProt: P0DTC2
• Buffer: PBS
• Purity: > 55% as determined by SDS-PAGE
• Form: liquid
• Sequence: MVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTN GTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQ FCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVF KNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDS SSGWTAGAAA
• Formula: pH 7,4

Images

Structural model of S Protein GFP His-Tag Stabilized Trimer

SDS-Page of S Protein GFP His-Tag Stabilized Trimer

Histogram of S Protein GFP His-Tag Stabilized Trimer