SARS-CoV-2 (COVID-19) S protein, GFP/His-Tag, stabilized trimer

Catalog Number: TRZ-P2020-030_100
Article Name: SARS-CoV-2 (COVID-19) S protein, GFP/His-Tag, stabilized trimer
Biozol Catalog Number: TRZ-P2020-030_100
Supplier Catalog Number: P2020-030_100
Alternative Catalog Number: TRZ-P2020-030_100
Manufacturer: trenzyme
Category: Biochemikalien
Application: ELISA, FA, WB
Species Reactivity: Virus
Alternative Names: SARS-CoV-2, coronavirus, SARS-CoV-2 spike protein, S glycoprotein, spike glycoprotein, 2019-nCoV, COVID-2019, COVID-19, covid-19, sars-cov-2
The SARS-CoV-2 spike is presented as a trimeric structure on the surface of the virus. It consists of three identical transmembrane proteins, called spike proteins, each containing two subunits: the S1 and the S2 subunit. The S1 is necessary for the recognition of the receptor on the surface of a susceptible cell. In addition, the S2 subunit is responsible for the fusion of the virus with the cell membrane of the host cell. Upon binding of the host receptor hACE2, the distal S1 domain is cleaved. This reveals the fusion machinery of the S2 subunit, which mediates the entry into the cell. Moreover, the Spike protein is heavily glycosylated by N-linked glycans that are important for the proper folding of the protein and the recognition by neutralizing antibodies. The engineered recombinant Spike protein contains specific amino acid substitutions to stabilize the prefusion confirmation (2P). Furthermore, the furin cleavage site at the boundary between the S1/S2 subunits was deleted and an artificial trimerization domain was added to the C-terminal end of the monomer. The protein contains furthermore GFP as fusion partner at the C-terminal end. Above all, the spike is a major immunogen and an interesting target for vaccine development as well as for serological assays.
Molecular Weight: 168,1 kDa per monomer
UniProt: P0DTC2
Buffer: PBS
Purity: > 55% as determined by SDS-PAGE
Form: liquid
Sequence: MVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTN GTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQ FCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVF KNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDS SSGWTAGAAA
Formula: pH 7,4
Structural model of S Protein GFP His-Tag Stabilized Trimer
SDS-Page of S Protein GFP His-Tag Stabilized Trimer
Histogram of S Protein GFP His-Tag Stabilized Trimer