SARS-CoV-2 (COVID-19) S protein, GFP/His-Tag, stabilized trimer

Catalog Number: TRZ-P2020-030_100
Article Name: SARS-CoV-2 (COVID-19) S protein, GFP/His-Tag, stabilized trimer
Biozol Catalog Number: TRZ-P2020-030_100
Supplier Catalog Number: P2020-030_100
Alternative Catalog Number: TRZ-P2020-030_100
Manufacturer: trenzyme
Category: Biochemikalien
Application: ELISA, FA, WB
Species Reactivity: Virus
Alternative Names: SARS-CoV-2, coronavirus, SARS-CoV-2 spike protein, S glycoprotein, spike glycoprotein, 2019-nCoV, COVID-2019, COVID-19, covid-19, sars-cov-2
The SARS-CoV-2 spike is presented as a trimeric structure on the surface of the virus. It consists of three identical transmembrane proteins, called spike proteins, each containing two subunits: the S1 and the S2 subunit. The S1 is necessary for the reco
Molecular Weight: 168,1 kDa per monomer
UniProt: P0DTC2
Buffer: PBS
Purity: > 55% as determined by SDS-PAGE
Form: liquid
Sequence: MVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTN GTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQ FCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVF KNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDS SSGWTAGAAA
Formula: pH 7,4
Structural model of S Protein GFP His-Tag Stabilized Trimer
SDS-Page of S Protein GFP His-Tag Stabilized Trimer
Histogram of S Protein GFP His-Tag Stabilized Trimer