SARS-CoV-2 S1 (RBD) Cluster 5 (Denmark)

Catalog Number: TRZ-P2020-033_100
Article Name: SARS-CoV-2 S1 (RBD) Cluster 5 (Denmark)
Biozol Catalog Number: TRZ-P2020-033_100
Supplier Catalog Number: P2020-033_100
Alternative Catalog Number: TRZ-P2020-033_100
Manufacturer: trenzyme
Category: Biochemikalien
Species Reactivity: Virus
Alternative Names: SARS-CoV-2, coronavirus, SARS-CoV-2 spike RBD, SARS-CoV-2 spike protein, 2019-nCoV, COVID-2019, COVID-19, RBD (Y453F), Danish Mink mutation, Cluster 5 Mutation, deltaFVI spike, sars-cov-2
The spike (S) glycoprotein of coronaviruses is essential for binding of the virus to the host cell at the beginning of the infection process. The target protein is also a major immunogen and a possible target for entry inhibitors. The SARS-CoV-2 spike (S) protein is a large type I transmembrane protein composed of two subunits, S1 and S2. The S1 subunit contains a receptor-binding domain (RBD) responsible for binding to the host cell receptor angiotensin-converting enzyme 2 (ACE2). Several mutants of the spike protein are known. A mutation first discovered in Denmark, called “Cluster 5”, also known as the ΔFVI-spike, is related to four genetic changes. This mutation (Y453F) is located in a conservative region of the RBD directly involved in ACE2 binding and thereby could have implications for viral fitness, transmissibility, and antigenicity.
Molecular Weight: 27,5 kDa
UniProt: P0DTC2
Buffer: PBS
Purity: > 80% as determined by SDS-PAGE
Form: liquid
Sequence: MRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYA DSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLfRLFRKSNLKPFERDISTEIYQAG STPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF
Formula: pH 7,4
SDS-Page of SARS-CoV-2 S1 (RBD) Cluster 5 (Denmark)
Structural model of SARS-CoV-2 S1 (RBD) Cluster 5 (Denmark)
Histogram of SARS-CoV-2 S1 (RBD) Cluster 5 (Denmark)