SARS-CoV-2 S1 (RBD) Cluster 5 (Denmark)

Product Overview

• Article Name: SARS-CoV-2 S1 (RBD) Cluster 5 (Denmark)
• Biozol Catalog Number: TRZ-P2020-033_100
• Supplier Catalog Number: P2020-033_100
• Alternative Catalog Number: TRZ-P2020-033_100
• Manufacturer: trenzyme
• Category: Biochemikalien
• Species Reactivity: Virus
• Alternative Names: SARS-CoV-2, coronavirus, SARS-CoV-2 spike RBD, SARS-CoV-2 spike protein, 2019-nCoV, COVID-2019, COVID-19, RBD (Y453F), Danish Mink mutation, Cluster 5 Mutation, deltaFVI spike, sars-cov-2

Product Description

The spike (S) glycoprotein of coronaviruses is essential for binding of the virus to the host cell at the beginning of the infection process. The target protein is also a major immunogen and a possible target for entry inhibitors. The SARS-CoV-2 spike (S

Product Properties

• Molecular Weight: 27,5 kDa
• UniProt: P0DTC2
• Buffer: PBS
• Purity: > 80% as determined by SDS-PAGE
• Form: liquid
• Sequence: MRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYA DSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLfRLFRKSNLKPFERDISTEIYQAG STPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF
• Formula: pH 7,4

Images

SDS-Page of SARS-CoV-2 S1 (RBD) Cluster 5 (Denmark)

Structural model of SARS-CoV-2 S1 (RBD) Cluster 5 (Denmark)

Histogram of SARS-CoV-2 S1 (RBD) Cluster 5 (Denmark)