hGuanylatekinase, His-Tag

Product Overview

• Article Name: hGuanylatekinase, His-Tag
• Biozol Catalog Number: TRZ-P2020-107_100
• Supplier Catalog Number: P2020-107_100
• Alternative Catalog Number: TRZ-P2020-107_100
• Manufacturer: trenzyme
• Category: Biochemikalien
• Application: ELISA, FA, WB
• Species Reactivity: Human
• Alternative Names: guanosine monophosphate kinase, GMK, GMPK, Guanylate kinase, GUK1, hGMPK, human Guanylate kinase, GMP Kinase

Product Description

Human Guanylate kinase is the only known enzyme which catalyzes the ATP-dependant phosphorylation of cellular guanosine monophosphate kinase (GMP) into guanosine monophosphate kinase (GDP). Process is crucial for GMP and cyclic guanosine monophosphate (c

Product Properties

• Molecular Weight: 24,1 kDa
• UniProt: Q16774
• Buffer: PBS
• Purity: > 95% as determined by SDS-PAGE
• Form: liquid
• Sequence: MSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTGA
• Formula: pH 7,4

Images

SDS-Page of hGuanylatkinase His-Tag

Structural model of hGuanylatkinase His-Tag

Histogram of hGuanylatkinase His-Tag