PsiMP glycosidase

Product Overview

• Article Name: PsiMP glycosidase
• Biozol Catalog Number: TRZ-P2020-109_100
• Supplier Catalog Number: P2020-109_100
• Alternative Catalog Number: TRZ-P2020-109_100
• Manufacturer: trenzyme
• Category: Biochemikalien
• Species Reactivity: E. coli
• Alternative Names: Pseudouridine 5-phosphate glycosidase, PsiMP glycosidase

Product Description

The enzymes PsiMP glycosidase and pseudouridine kinase are encoded by separate genes in bacterial genomes. PsiMP glycosidase is encoded by the yeiN gene, and pseudouridine kinase is encoded by the yeiC gene. Both genes belong to the same operon. In humans and other higher organisms, pseudouridine kinase and PsiMP glycosidase are not found. However, they are present in some eukaryotes as the only bifunctional enzymes. In the process of pseudouridine degradation, when pseudouridine kinase phosphorylates pseudouridine, pseudouridine 5'-phosphate (PsiMP) is formed as a degradation product of RNAs. PsiMP is a non-classical nucleoside that has a glycosidic C-C bond and is present in human urine.

Product Properties

• Molecular Weight: 35,2 kDa
• UniProt: P33025
• Buffer: PBS
• Purity: > 95% as determined by SDS-PAGE
• Form: liquid
• Sequence: MSELKISPELLQISPEVQDALKNKKPVVALESTIISHGMPF PQNAQTAIEVEETIRKQGAVPATIAIIGGVMKVGLSKEEIELLGREGHNVTKVSRRDLPF VVAAGKNGATTVASTMIIAALAGIKVFATGGIGGVHRGAEHTFDISADLQELANTNVTVV CAGAKSILDLGLTTEYLETFGVPLIGYQTKALPAFFCRTSPFDVSIRLDSASEIARAMVV KWQSGLNGGLVVANPIPEQFAMPEHTINA
• Formula: pH 7,4

Images

SDS-Page of PsiMP glycosidase

Structural model of PsiMP glycosidase

Histogram of PsiMP glycosidase