PsiMP glycosidase

Catalog Number: TRZ-P2020-109_100
Article Name: PsiMP glycosidase
Biozol Catalog Number: TRZ-P2020-109_100
Supplier Catalog Number: P2020-109_100
Alternative Catalog Number: TRZ-P2020-109_100
Manufacturer: trenzyme
Category: Biochemikalien
Species Reactivity: E. coli
Alternative Names: Pseudouridine 5-phosphate glycosidase, PsiMP glycosidase
The enzymes PsiMP glycosidase and pseudouridine kinase are encoded by separate genes in bacterial genomes. PsiMP glycosidase is encoded by the yeiN gene, and pseudouridine kinase is encoded by the yeiC gene. Both genes belong to the same operon. In humans and other higher organisms, pseudouridine kinase and PsiMP glycosidase are not found. However, they are present in some eukaryotes as the only bifunctional enzymes. In the process of pseudouridine degradation, when pseudouridine kinase phosphorylates pseudouridine, pseudouridine 5-phosphate (PsiMP) is formed as a degradation product of RNAs. PsiMP is a non-classical nucleoside that has a glycosidic C-C bond and is present in human urine.
Molecular Weight: 35,2 kDa
UniProt: P33025
Buffer: PBS
Purity: > 95% as determined by SDS-PAGE
Form: liquid
Sequence: MSELKISPELLQISPEVQDALKNKKPVVALESTIISHGMPF PQNAQTAIEVEETIRKQGAVPATIAIIGGVMKVGLSKEEIELLGREGHNVTKVSRRDLPF VVAAGKNGATTVASTMIIAALAGIKVFATGGIGGVHRGAEHTFDISADLQELANTNVTVV CAGAKSILDLGLTTEYLETFGVPLIGYQTKALPAFFCRTSPFDVSIRLDSASEIARAMVV KWQSGLNGGLVVANPIPEQFAMPEHTINAA
Formula: pH 7,4
SDS-Page of PsiMP glycosidase
Structural model of PsiMP glycosidase
Histogram of PsiMP glycosidase