Alpha-1-antitrypsin, Human

Catalog Number: TRZ-P2020-112_1000
Article Name: Alpha-1-antitrypsin, Human
Biozol Catalog Number: TRZ-P2020-112_1000
Supplier Catalog Number: P2020-112_1000
Alternative Catalog Number: TRZ-P2020-112_1000
Manufacturer: trenzyme
Host: Human
Category: Biochemikalien
Application: ELISA, FA, WB
Species Reactivity: Human
Alternative Names: Alpha-1 protease inhibitor, Alpha-1-antiproteinase, Serpin A1, A1AT Protein, Alfa1 antitrypsin, Alpha 1-antitrypsin, Alpha 1-Proteinase Inhibitor, Alpha 1-proteinase inhibitor (human), Alpha 1-proteinase inhibitor, human, Alpha-1 protease inhibitor, Alpha-1 proteinase inhibitor (human), Alpha-1-antiproteinase, Alpha-1-antitrypsin, Alpha-1-proteinase Inhibitor (human), Alpha-1-proteinase inhibitor human, Alpha-1-proteinase Inhibitor, Human, Alpha-1-proteinase inhibitor,human, Alpha1-proteinase Inhibitor, Alpha1-proteinase inhibitor (human), alpha1-proteinase inhibitor human, API
Alpha-1-antitrypsin also known as Alpha-1 proteinase inhibitor is a serine protease inhibitor (Serpin). Its primary mechanism is inhibiting the action of the serine protease called elastase (also plasmin and thrombin) preventing the proteolysis of elastin tissues in alveolar lung structures. The reactive center loop (RCL) of alpha-1 proteinase inhibitor extends out from the body of the protein and directs binding to the target protease. The protease cleaves the serpin at the reactive site, establishing a covalent linkage between the carboxyl group of the serpin reactive site and the serine hydroxyl of the protease. The resulting inactive serpin-protease complex is highly stable.
Molecular Weight: 45,8 kDa
UniProt: P01009
Buffer: 10 mM Tris, 200 mM NaCl, 1 mM EDTA, 1 mM ß-Mercaptoethanol
Purity: > 95% as determined by SDS-PAGE
Form: liquid
Sequence: EDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLP
Formula: pH 8,0
Structural model of Alpha 1 antitrypsin
SDS-Page of Alpha 1 antitrypsin
Histogram of Alpha 1 antitrypsin
SDS-Page of Alpha 1 antitrypsin