African swine fever virus (ASVF) Phosphoprotein p30 - E.coli

Catalog Number: TRZ-P2020-113_100
Article Name: African swine fever virus (ASVF) Phosphoprotein p30 - E.coli
Biozol Catalog Number: TRZ-P2020-113_100
Supplier Catalog Number: P2020-113_100
Alternative Catalog Number: TRZ-P2020-113_100
Manufacturer: trenzyme
Category: Biochemikalien
Species Reactivity: Virus
Alternative Names: CP204L, Isolate: CN/2019/InnerMongolia-AES01, ASFV/Primorsky 19/WB-6723, ASFV Georgia 2007/1
The african swine fever virus (ASFV) is a large (approx. 200 nm) enveloped virus with an icosahedral capsid and two membranes at its inner and outer sides belonging to the Asfarviridae family. It is the only known virus with double-stranded DNA genome to
Molecular Weight: 41,5 kDa
UniProt: B9UNA3
Buffer: PBS
Purity: > 75% as determined by SDS-PAGE
Form: liquid
Sequence: MILHVLFEEETESSASSENIHEKNDNETNECTSSFETLFEQEPSSEVPKDSKLYMLAQKTVQHIEQYGKAPDFNKVIRAHNFIQTIYGTPLKEEEKEVVRLMVIKLLKKK
Formula: pH 7,4
SDS-Page of African swine fever virus (ASFV) Phosphoprotein p30 - E.coli
Histogram of African swine fever virus (ASFV) Phosphoprotein p30 - E.coli