pro-TGF-beta 1, GFP/His-Tag, Human

Catalog Number: TRZ-P2020-118_1000
Article Name: pro-TGF-beta 1, GFP/His-Tag, Human
Biozol Catalog Number: TRZ-P2020-118_1000
Supplier Catalog Number: p2020-118_1000
Alternative Catalog Number: TRZ-P2020-118_1000
Manufacturer: trenzyme
Host: Human
Category: Biochemikalien
Species Reactivity: Human
Alternative Names: Latent TGF-beta1, small latent TGF-beta1 complex, Transforming growth factor beta-1 proprotein, Latency-associated peptide, Transforming growth factor beta 1, TGF-beta1
Transforming growth factor beta 1 or TGF-beta1 is a polypeptide member of the transforming growth factor beta superfamily of cytokines. It is a secreted protein that performs many cellular functions, including the control of cell growth, cell proliferation,
Molecular Weight: 71,4 kDa
UniProt: P01137
Buffer: PBS
Purity: > 95% as determined by SDS-PAGE
Form: liquid
Sequence: MLSTSKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGEVPPG PLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVETHNEIYDKFKQSTHSI YMFFNTSELREAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSNNSWRYLSNRLLAPSD SPEWLSFDVTGVVRQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFTTGRRGDLATIH GMNRPFLLLMATPLERAQHLQSSRHRR
Formula: pH 7,4
SDS-Page of pro-TGF-beta 1 GFP/His-Tag
Structural model of pro-TGF-beta 1 GFP/His-Tag
Histogram of pro-TGF-beta 1 GFP/His-Tag
SDS-Page of pro-TGF-beta 1 GFP/His-Tag