pro-TGF-beta 1, GFP/His-Tag, Human

Product Overview

• Article Name: pro-TGF-beta 1, GFP/His-Tag, Human
• Biozol Catalog Number: TRZ-P2020-118_1000
• Supplier Catalog Number: p2020-118_1000
• Alternative Catalog Number: TRZ-P2020-118_1000
• Manufacturer: trenzyme
• Host: Human
• Category: Biochemikalien
• Species Reactivity: Human
• Alternative Names: Latent TGF-beta1, small latent TGF-beta1 complex, Transforming growth factor beta-1 proprotein, Latency-associated peptide, Transforming growth factor beta 1, TGF-beta1

Product Description

Transforming growth factor beta 1 or TGF-beta1 is a polypeptide member of the transforming growth factor beta superfamily of cytokines. It is a secreted protein that performs many cellular functions, including the control of cell growth, cell proliferation,

Product Properties

• Molecular Weight: 71,4 kDa
• UniProt: P01137
• Buffer: PBS
• Purity: > 95% as determined by SDS-PAGE
• Form: liquid
• Sequence: MLSTSKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGEVPPG PLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVETHNEIYDKFKQSTHSI YMFFNTSELREAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSNNSWRYLSNRLLAPSD SPEWLSFDVTGVVRQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFTTGRRGDLATIH GMNRPFLLLMATPLERAQHLQSSRHRR
• Formula: pH 7,4

Images

SDS-Page of pro-TGF-beta 1 GFP/His-Tag

Structural model of pro-TGF-beta 1 GFP/His-Tag

Histogram of pro-TGF-beta 1 GFP/His-Tag

SDS-Page of pro-TGF-beta 1 GFP/His-Tag