African swine fever virus (ASVF) Phosphoprotein p30 - Mammalian, Human

Product Overview

• Article Name: African swine fever virus (ASVF) Phosphoprotein p30 - Mammalian, Human
• Biozol Catalog Number: TRZ-P2020-120_100
• Supplier Catalog Number: P2020-120_100
• Alternative Catalog Number: TRZ-P2020-120_100
• Manufacturer: trenzyme
• Host: Human
• Category: Biochemikalien
• Species Reactivity: Virus
• Alternative Names: CP204L, Isolate: CN/2019/InnerMongolia-AES01, ASFV/Primorsky 19/WB-6723, ASFV Georgia 2007/1

Product Description

The african swine fever virus (ASFV) is a large (approx. 200 nm) enveloped virus with an icosahedral capsid and two membranes at its inner and outer sides belonging to the Asfarviridae family. It is the only known virus with double-stranded DNA genome to

Product Properties

• Molecular Weight: 41,2 kDa
• UniProt: B9UNA3
• Buffer: PBS
• Purity: > 95% as determined by SDS-PAGE
• Form: liquid
• Sequence: MILHVLFEEETESSASSENIHEKNDNETNECTSSFETLFEQEPSSEVPKDSKLYMLAQKT VQHIEQYGKAPDFNKVIRAHNFIQTIYGTPLKEEEKEVVRLMVIKLLKKK
• Formula: pH 7,4

Images

SDS-Page of African swine fever virus (ASFV) Phosphoprotein p30 Mammalian

Histogram of African swine fever virus (ASFV) Phosphoprotein p30 Mammalian