pro-activin A, GFP/His-tag, Human

Product Overview

• Article Name: pro-activin A, GFP/His-tag, Human
• Biozol Catalog Number: TRZ-P2020-121_1000
• Supplier Catalog Number: P2020-121_1000
• Alternative Catalog Number: TRZ-P2020-121_1000
• Manufacturer: trenzyme
• Host: Human
• Category: Biochemikalien
• Application: ELISA, FA, WB
• Species Reactivity: Human
• Alternative Names: Activin beta-A chain, Erythroid differentiation protein (EDF), latent Activin A protein, inhibin beta A chain, inhibin beta A subunit

Product Description

Activin A belongs to the TGF-beta superfamily of cytokines and is a disulfide-linked homodimer consisting of four inhibin betaA chains. Any acitivin is expressed as latent complex, in which the pro-domain of activin is noncovalently linked to the mature,

Product Properties

• Molecular Weight: 73,3 kDa
• UniProt: P08476
• Buffer: PBS
• Purity: > 95% as determined by SDS-PAGE
• Form: liquid
• Sequence: MSPTPGSEGHSAAPDCPSCALAALPKDVPNSQPEMVEAVKKHILNMLHLKKRPDVTQPVP KAALLNAIRKLHVGKVGENGYVEIEDDIGRRAEMNELMEQTSEIITFAESGTARKTLHFE ISKEGSDLSVVERAEVWLFLKVPKANRTRTKVTIRLFQQQKHPQGSLDTGEEAEEVGLKG ERSELLLSEKVVDARKSTWHVFPVSSSIQRLLDQGKSSLDVRIACEQCQESGASLVLLGK KKKKEEEGEG
• Formula: pH 7,4

Images

SDS-Page of pro-activin A GFP/His-tag

Structural model of pro-activin A GFP/His-tag

Histogram of pro-activin A GFP/His-tag