greenTEV, liquid, E. coli

Catalog Number: TRZ-P2020-123_1000
Article Name: greenTEV, liquid, E. coli
Biozol Catalog Number: TRZ-P2020-123_1000
Supplier Catalog Number: P2020-123_1000
Alternative Catalog Number: TRZ-P2020-123_1000
Manufacturer: trenzyme
Host: E. coli
Category: Biochemikalien
Application: ELISA, FA, WB
Alternative Names: TEV Protease, TEV, Tobacco Etch Virus nuclear-inclusion-a endopeptidase, rTEV, P1 protease, EC 3.4.22.44
greenTEV represents the catalytic domain of the nuclear inclusion a (NIa) protein with a molecular weight of 27 kDa encoded by the plant virus Tobacco Etch Virus. green indicates fusion of the protease to green fluorescent protein (GFP), which leads to
Molecular Weight: 53,7 kDa
UniProt: Q0GDU8
Buffer: 50 mM Tris, 150 mM NaCl, 0.5 mM EDTA, 40% Glycerol
Purity: > 85% as determined by SDS-PAGE
Form: liquid
Sequence: KGPRDYNPISSSICHLTNESDGHTTSLYGIGFGPFIITNKHLFRRNNGTLVVQSLHGVFK VKDTTTLQQHLVDGRDMIIIRMPKDFPPFPQKLKFREPQREERICLVTTNFQTKSMSSMV SDTSCTFPSGDGIFWKHWIQTKDGQCGSPLVSTRDGFIVGIHSASNFTNTNNYFTSVPKN FMELLTNQEAQQWVSGWRLNADSVLWGGHKVFMVKPEEPFQPVKEATQLMNE
Formula: pH 8,0