hCELA3A, His-Tag, inactive variant S217A, Human

Catalog Number: TRZ-P2020-129_100
Article Name: hCELA3A, His-Tag, inactive variant S217A, Human
Biozol Catalog Number: TRZ-P2020-129_100
Supplier Catalog Number: P2020-129_100
Alternative Catalog Number: TRZ-P2020-129_100
Manufacturer: trenzyme
Host: Human
Category: Biochemikalien
Application: ELISA, FA, WB
Species Reactivity: Human
Alternative Names: Chymotrypsin-like elastase family member 3A, Elastase IIIA, Elastase-3A, ELA3, ELA3A, Protease E, OTTHUMP00000002835, elastase 3A, pancreatic, inactive variant, catalytically inactive
Chymotrypsin-like elastases (CELAs) are pancreatic serine proteinases, which belong to the peptidase S1 family, a subfamily of serine proteases. The human CELA3A is a member of the elastase family, which consists of six human elastase genes encoding the
Molecular Weight: 30,1 kDa
UniProt: P09093
Buffer: PBS
Purity: > 90% as determined by SDS-PAGE
Form: liquid
Sequence: SGYGPPSSHSSSRVVHGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISRDLTYQVVLGEYNLAVKEGPEQVIPINSEELFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNKTPCYITGWGRLYTNGPLPDKLQQARLPVVDYKHCSRWNWWGSTVKKTMVCAGGYIRSGCNGDAGGPLNCPTEDGGWQVHGVTSFVSAFGCNFIWKPTVFTRVSAFIDWIEETIAS
Formula: pH 7,4
SDS-Page of hCELA3A His-Tag inactive variant S217A
Structural model of hCELA3A His-Tag inactive variant S217A
Histogram of hCELA3A His-Tag inactive variant S217A