hCELA3A, His-Tag, inactive variant S217A, Human

Product Overview

• Article Name: hCELA3A, His-Tag, inactive variant S217A, Human
• Biozol Catalog Number: TRZ-P2020-129_1000
• Supplier Catalog Number: P2020-129_1000
• Alternative Catalog Number: TRZ-P2020-129_1000
• Manufacturer: trenzyme
• Host: Human
• Category: Biochemikalien
• Application: ELISA, FA, WB
• Species Reactivity: Human
• Alternative Names: Chymotrypsin-like elastase family member 3A, Elastase IIIA, Elastase-3A, ELA3, ELA3A, Protease E, OTTHUMP00000002835, elastase 3A, pancreatic, inactive variant, catalytically inactive

Product Description

Chymotrypsin-like elastases (CELAs) are pancreatic serine proteinases, which belong to the peptidase S1 family, a subfamily of serine proteases. The human CELA3A is a member of the elastase family, which consists of six human elastase genes encoding the

Product Properties

• Molecular Weight: 30,1 kDa
• UniProt: P09093
• Buffer: PBS
• Purity: > 90% as determined by SDS-PAGE
• Form: liquid
• Sequence: SGYGPPSSHSSSRVVHGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISRDLTYQVVLGEYNLAVKEGPEQVIPINSEELFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNKTPCYITGWGRLYTNGPLPDKLQQARLPVVDYKHCSRWNWWGSTVKKTMVCAGGYIRSGCNGDAGGPLNCPTEDGGWQVHGVTSFVSAFGCNFIWKPTVFTRVSAFIDWIEETIAS
• Formula: pH 7,4

Images

SDS-Page of hCELA3A His-Tag inactive variant S217A

Structural model of hCELA3A His-Tag inactive variant S217A

Histogram of hCELA3A His-Tag inactive variant S217A