hCELA3B, His-Tag, inactive variant S217A, Human

Catalog Number: TRZ-P2020-132_100
Article Name: hCELA3B, His-Tag, inactive variant S217A, Human
Biozol Catalog Number: TRZ-P2020-132_100
Supplier Catalog Number: p2020-132_100
Alternative Catalog Number: TRZ-P2020-132_100
Manufacturer: trenzyme
Host: Human
Category: Biochemikalien
Application: ELISA, FA, WB
Species Reactivity: Human
Alternative Names: Chymotrypsin-like elastase family member 3B, Elastase IIIB, Elastase-3B, Protease E, ELA3B, elastase 3B, pancreatic, inactive variant, catalytically inactive
Chymotrypsin-like elastases (CELAs) are pancreatic serine proteinases, which belong to the peptidase S1 family, a subfamily of serine proteases. The human CELA3B is a member of the elastase family, which consists of six human elastase genes encoding the proteins elastase 1, 2, 2A, 2B, 3A, and 3B, all of which are structurally similar. Typically, elastases hydrolyze many proteins in addition to elastin. However, CELA3B has only little elastolytic activity. CELA3B is secreted by the pancreas and characterized by a digestive function in the intestine, very similar to other serine proteases such as trypsin, chymotrypsin and kallikrein. The amino acid S217 of CELA3B is part of the catalytic triade typical for all serine proteases. By substitution of this amino acid by a different one (S217A), the enzyme is loosing its catalytic activity. In clinical assays, pancreatic function is analyzed by excretion of CELA3B in fecal material.
Molecular Weight: 29,8 kDa
UniProt: P08861
Buffer: PBS
Purity: > 95% as determined by SDS-PAGE
Form: liquid
Sequence: YGPPSSRPSSRVVNGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISSSRTYQVVLGEYDRAVKEGPEQVIPINSGDLFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNETPCYITGWGRLYTNGPLPDKLQEALLPVVDYEHCSRWNWWGSSVKKTMVCAGGDIRSGCNGDAGGPLNCPTEDGGWQVHGVTSFVSAFGCNTRRKPTVFTRVSAFIDWIEETIASH
Formula: pH 7,4
SDS-Page of hCELA3B His-Tag inactive variant S217A
Structural model of hCELA3B His-Tag inactive variant S217A
Histogram of hCELA3B His-Tag inactive variant S217A