hCELA3B, His-Tag, inactive variant S217A, Human

Product Overview

• Article Name: hCELA3B, His-Tag, inactive variant S217A, Human
• Biozol Catalog Number: TRZ-P2020-132_100
• Supplier Catalog Number: p2020-132_100
• Alternative Catalog Number: TRZ-P2020-132_100
• Manufacturer: trenzyme
• Host: Human
• Category: Biochemikalien
• Application: ELISA, FA, WB
• Species Reactivity: Human
• Alternative Names: Chymotrypsin-like elastase family member 3B, Elastase IIIB, Elastase-3B, Protease E, ELA3B, elastase 3B, pancreatic, inactive variant, catalytically inactive

Product Description

Chymotrypsin-like elastases (CELAs) are pancreatic serine proteinases, which belong to the peptidase S1 family, a subfamily of serine proteases. The human CELA3B is a member of the elastase family, which consists of six human elastase genes encoding the

Product Properties

• Molecular Weight: 29,8 kDa
• UniProt: P08861
• Buffer: PBS
• Purity: > 95% as determined by SDS-PAGE
• Form: liquid
• Sequence: YGPPSSRPSSRVVNGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISSSRTYQVVLGEYDRAVKEGPEQVIPINSGDLFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNETPCYITGWGRLYTNGPLPDKLQEALLPVVDYEHCSRWNWWGSSVKKTMVCAGGDIRSGCNGDAGGPLNCPTEDGGWQVHGVTSFVSAFGCNTRRKPTVFTRVSAFIDWIEETIASH
• Formula: pH 7,4

Images

SDS-Page of hCELA3B His-Tag inactive variant S217A

Structural model of hCELA3B His-Tag inactive variant S217A

Histogram of hCELA3B His-Tag inactive variant S217A