hCELA3B, His-Tag, inactive variant S217A, Human

Catalog Number: TRZ-P2020-132_1000
Article Name: hCELA3B, His-Tag, inactive variant S217A, Human
Biozol Catalog Number: TRZ-P2020-132_1000
Supplier Catalog Number: p2020-132_1000
Alternative Catalog Number: TRZ-P2020-132_1000
Manufacturer: trenzyme
Host: Human
Category: Biochemikalien
Application: ELISA, FA, WB
Species Reactivity: Human
Alternative Names: Chymotrypsin-like elastase family member 3B, Elastase IIIB, Elastase-3B, Protease E, ELA3B, elastase 3B, pancreatic, inactive variant, catalytically inactive
Chymotrypsin-like elastases (CELAs) are pancreatic serine proteinases, which belong to the peptidase S1 family, a subfamily of serine proteases. The human CELA3B is a member of the elastase family, which consists of six human elastase genes encoding the
Molecular Weight: 29,8 kDa
UniProt: P08861
Buffer: PBS
Purity: > 95% as determined by SDS-PAGE
Form: liquid
Sequence: YGPPSSRPSSRVVNGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISSSRTYQVVLGEYDRAVKEGPEQVIPINSGDLFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNETPCYITGWGRLYTNGPLPDKLQEALLPVVDYEHCSRWNWWGSSVKKTMVCAGGDIRSGCNGDAGGPLNCPTEDGGWQVHGVTSFVSAFGCNTRRKPTVFTRVSAFIDWIEETIASH
Formula: pH 7,4
SDS-Page of hCELA3B His-Tag inactive variant S217A
Structural model of hCELA3B His-Tag inactive variant S217A
Histogram of hCELA3B His-Tag inactive variant S217A