Interleukin-13 receptor subunit alpha-1, Fc/His-tag, Human

Catalog Number: TRZ-P2020-134_100
Article Name: Interleukin-13 receptor subunit alpha-1, Fc/His-tag, Human
Biozol Catalog Number: TRZ-P2020-134_100
Supplier Catalog Number: p2020-134_100
Alternative Catalog Number: TRZ-P2020-134_100
Manufacturer: trenzyme
Host: Human
Category: Biochemikalien
Application: ELISA, FA, WB
Species Reactivity: Human
Alternative Names: IL-13 receptor subunit alpha-1, IL-13R subunit alpha-1, IL-13R-alpha-1, IL-13RA1, IL13RA1, IL-13Ra Protein, CD213A1 Protein, Cancer/testis antigen 19, CT19, Fc-fuion
Interleukin 13 Receptor alpha 1 (IL13RA1) is part of the interleukin 13 (IL-13) receptor complex expressed on the surface of various cells, including B cells, mononuclear phagocytes, dendritic cells, eosinophils, basophils, bronchial epithelial cells, an
Molecular Weight: 66 kDa
UniProt: P78552
Buffer: PBS
Purity: > 95% as determined by SDS-PAGE
Form: liquid
Sequence: MGGGGAAPTETQPPVTNLSVSVENLCTVIWTWNPPEGASSNCSLWYFSHFGDKQDKKIAPETRRSIEVPLNERICLQVGSQCSTNESEKPSILVEKCISPPEGDPESAVTELQCIWHNLSYMKCSWLPGRNTSPDTNYTLYYWHRSLEKIHQCENIFREGQYFGCSFDLTKVKDSSFEQHSVQIMVKDNAGKIKPSFNIVPLTSRVKPDPPHIKNLSFHNDDLYVQWENPQNFISRCLFYEVEVNNSQTETHNV
Formula: pH 7,4
SDS-Page of Interleukin-13 receptor subunit alpha-1 Fc/His-tag
Structural model of Interleukin-13 receptor subunit alpha-1 Fc/His-tag
Histogram of Interleukin-13 receptor subunit alpha-1 Fc/His-tag
SDS-Page of Interleukin-13 receptor subunit alpha-1 Fc/His-tag