human Interleukin-1 beta, tag-free, E. coli

Catalog Number: TRZ-P2020-136_20
Article Name: human Interleukin-1 beta, tag-free, E. coli
Biozol Catalog Number: TRZ-P2020-136_20
Supplier Catalog Number: p2020-136_20
Alternative Catalog Number: TRZ-P2020-136_20
Manufacturer: trenzyme
Host: E. coli
Category: Biochemikalien
Application: ELISA, FA, WB
Species Reactivity: Human
Alternative Names: IL-1 beta, Catabolin, IL-1B, IL-1 beta Protein, IL1-BETA Protein, IL1F2 Protein
The pro-inflammatory cytokine Interleukin-1 beta (IL-1 beta) is produced by a variety of cell types, including macrophages, dendritic cells, fibroblasts, endothelial cells and keratinocytes. Activation of IL-1 beta is tightly regulated as it is first pro
Molecular Weight: 17,6 kDa
UniProt: P01584
Buffer: PBS
Purity: > 95% as determined by SDS-PAGE
Form: liquid
Sequence: MAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Formula: pH 7,4