blueTEV, lyophilized formulation, E. coli

Catalog Number: TRZ-P2020-137_200U
Article Name: blueTEV, lyophilized formulation, E. coli
Biozol Catalog Number: TRZ-P2020-137_200U
Supplier Catalog Number: P2020-137_200U
Alternative Catalog Number: TRZ-P2020-137_200U
Manufacturer: trenzyme
Host: E. coli
Category: Biochemikalien
Application: ELISA, FA, WB
Alternative Names: TEV Protease, TEV, Tobacco Etch Virus nuclear-inclusion-a endopeptidase, rTEV, P1 protease, EC 3.4.22.44
blueTEV represents the catalytic domain of the nuclear inclusion a (NIa) protein with a molecular weight of 27 kDa encoded by the plant virus Tobacco Etch Virus. blue indicates fusion of the protease to blue fluorescent protein (BFP), which leads to in
Molecular Weight: 53,7 kDa
UniProt: Q0GDU8
Buffer: 50 mM Tris, 150 mM NaCl, 0.5 mM EDTA, 5% Trehalose
Purity: > 85% as determined by SDS-PAGE
Form: lyophilized
Sequence: KGPRDYNPISSSICHLTNESDGHTTSLYGIGFGPFIITNKHLFRRNNGTLVVQSLHGVFKVKDTTTLQQHLVDGRDMIIIRMPKDFPPFPQKLKFREPQREERICLVTTNFQTKSMSSMVSDTSCTFPSGDGIFWKHWIQTKDGQCGSPLVSTRDGFIVGIHSASNFTNTNNYFTSVPKNFMELLTNQEAQQWVSGWRLNADSVLWGGHKVFMVKPEEPFQPVKEATQLMNE
Formula: pH 8,0