human Interleukin-4, His-tag, Human

Catalog Number: TRZ-P2020-139_100
Article Name: human Interleukin-4, His-tag, Human
Biozol Catalog Number: TRZ-P2020-139_100
Supplier Catalog Number: p2020-139_100
Alternative Catalog Number: TRZ-P2020-139_100
Manufacturer: trenzyme
Host: Human
Category: Biochemikalien
Application: ELISA, FA, WB
Species Reactivity: Human
Alternative Names: Interleukin 4, IL-4, IL4, B-cell stimulatory factor 1 (BSF-1), BSF1, Lymphocyte stimulatory factor 1, BCGF-1, BCGF1
Interleukin-4 (IL-4) is a member of the type 1 four-alpha-helical cytokine family and exerts its biological functions by binding to one of the two types of IL-4 receptors. The type I receptor is expressed on hematopoietic cells and constitutes a heterodi
Molecular Weight: 16,8 kDa
UniProt: P05112
Buffer: PBS
Purity: > 85% as determined by SDS-PAGE
Form: liquid
Sequence: MHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS
Formula: pH 7,4