human Interleukin-6, His-tag, Human

Product Overview

• Article Name: human Interleukin-6, His-tag, Human
• Biozol Catalog Number: TRZ-P2020-140_100
• Supplier Catalog Number: P2020-140_100
• Alternative Catalog Number: TRZ-P2020-140_100
• Manufacturer: trenzyme
• Host: Human
• Category: Biochemikalien
• Application: ELISA, FA, WB
• Species Reactivity: Human
• Alternative Names: Interleukin-6, IL-6, IL6, B-cell stimulatory factor 2 (BSF-2), BSF2, CTL differentiation factor (CDF), Hybridoma growth factor, Interferon beta-2 (IFN-beta-2), IFNB2

Product Description

Interleukin-6 (IL-6) is an important pro-inflammatory cytokine, which belongs to the type I cytokine family and is produced by a variety of cell types, including mononuclear phagocytes, dendritic cells, vascular endothelial cells and fibroblasts. Signali

Product Properties

• Molecular Weight: 22,6 kDa
• UniProt: P05231
• Buffer: PBS
• Purity: > 85% as determined by SDS-PAGE
• Form: liquid
• Sequence: MVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAEN NLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTK VLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRA LRQM
• Formula: pH 7,4