Fimbrial Protein (pilA), His-tag, E. coli

Catalog Number: TRZ-P2020-143_100
Article Name: Fimbrial Protein (pilA), His-tag, E. coli
Biozol Catalog Number: TRZ-P2020-143_100
Supplier Catalog Number: p2020-143_100
Alternative Catalog Number: TRZ-P2020-143_100
Manufacturer: trenzyme
Host: E. coli
Category: Biochemikalien
Species Reactivity: Bacteria
Alternative Names: PAK pilA, pilA, Pilin, PAK pilin, fimbrial protein, type 4 fimbrial protein PilA, type IV fimbrial protein
Pathogenic bacteria, such as Pseudomonas aeruginosa, have developed a variety of virulence factors facilitating the infection process. A prominent virulence factor are pilins essentially required for attachment of the pathogen to the host cell and thus t
Molecular Weight: 15,1 kDa
UniProt: P02973
Buffer: PBS
Purity: > 90% as determined by SDS-PAGE
Form: liquid
Sequence: MALEGTEFARSEGASALASVNPLKTTVEEALSRGWSVKSGTGTEDATKKEVPLGVAADAN KLGTIALKPDPADGTADITLTFTMGGAGPKNKGKIITLTRTAADGLWKCTSDQDEQFIPK GCSR
Formula: pH 7,4