human Interleukin-10, tag-free, Human

Catalog Number: TRZ-P2020-146_10
Article Name: human Interleukin-10, tag-free, Human
Biozol Catalog Number: TRZ-P2020-146_10
Supplier Catalog Number: p2020-146_10
Alternative Catalog Number: TRZ-P2020-146_10
Manufacturer: trenzyme
Host: Human
Category: Biochemikalien
Application: ELISA, FA, WB
Species Reactivity: Human
Alternative Names: Interleukin 10, IL-10, IL10, Cytokine synthesis inhibitory factor (CSIF), CSIF Protein, TGIF Protein, GVHDS
Interleukin-10 (IL-10) is a cytokine that plays a crucial role in the regulation of both innate and adaptive immune responses and controls inflammatory processes. It was first identified in the early 1990s and has since been extensively studied for its i
Molecular Weight: 18,8 kDa
UniProt: P22301
Buffer: PBS
Purity: > 90% as determined by SDS-PAGE
Form: liquid
Sequence: MSPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
Formula: pH 7,4