human BCMA, Fc/His-Tag, Human

Product Overview

• Article Name: human BCMA, Fc/His-Tag, Human
• Biozol Catalog Number: TRZ-P2020-148_100
• Supplier Catalog Number: P2020-148_100
• Alternative Catalog Number: TRZ-P2020-148_100
• Manufacturer: trenzyme
• Host: Human
• Category: Biochemikalien
• Application: ELISA, FA, WB
• Species Reactivity: Human
• Alternative Names: TNFRSF17, Tumor necrosis factor receptor superfamily member 17, CD269, CD antigen CD269, BCM, BCMA, B-cell maturation protein

Product Description

B cell maturation antigen (BCMA), also known as tumor necrosis factor receptor superfamily member 17 (TNFRSF17), is a transmembrane glycoprotein crucial for the survival and function of B lymphocytes, particularly plasma cells. Signaling via BCMA is indu

Product Properties

• Molecular Weight: 34,9 kDa
• UniProt: Q02223
• Buffer: PBS
• Purity: > 95 % as determined by SDS-PAGE
• Form: liquid
• Sequence: MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA
• Formula: pH 7,4