human CD28, Fc/His-Tag, Human

Product Overview

• Article Name: human CD28, Fc/His-Tag, Human
• Biozol Catalog Number: TRZ-P2020-154_100
• Supplier Catalog Number: P2020-154_100
• Alternative Catalog Number: TRZ-P2020-154_100
• Manufacturer: trenzyme
• Host: Human
• Category: Biochemikalien
• Application: ELISA, FA, WB
• Species Reactivity: Human
• Alternative Names: CD28 antigen, T-cell-specific surface glycoprotein CD28, TP44

Product Description

Cluster of differentiation 28 (CD28) is a member of the immunoglobulin superfamily representing a type I transmembrane glycoprotein and is constitutively expressed on the surface of more than 80 % CD4+ T cells and 50 % CD8+ T cells in humans, whereas in

Product Properties

• Molecular Weight: 44,2 kDa
• UniProt: P10747
• Buffer: PBS
• Purity: > 95 % as determined by SDS-PAGE
• Form: liquid
• Sequence: MNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP
• Formula: pH 7,4