human PD-1, His-Tag, Human

Product Overview

• Article Name: human PD-1, His-Tag, Human
• Biozol Catalog Number: TRZ-P2020-163_100
• Supplier Catalog Number: P2020-163_100
• Alternative Catalog Number: TRZ-P2020-163_100
• Manufacturer: trenzyme
• Host: Human
• Category: Biochemikalien
• Application: ELISA, FA, WB
• Species Reactivity: Human
• Alternative Names: Programmed cell death protein 1, Protein PD-1, hPD-1, CD279, PDCD1

Product Description

Activated T cells express the programmed cell death protein 1 (PD-1), which belongs to the CD28 family of the immunoglobulin superfamily. As immune checkpoint receptor, PD-1 represents a key player in modulating adaptive immune responses to prevent both

Product Properties

• Molecular Weight: 18,7 kDa
• UniProt: Q15116
• Buffer: PBS
• Purity: > 95 % as determined by SDS-PAGE
• Form: liquid
• Sequence: MLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFP EDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELR VTERRAEVPTAHPSPSPRPAGQFQT
• Formula: pH 7,4