human HER2/ErbB2, Fc/His-Tag, Human

Catalog Number: TRZ-P2020-166_100
Article Name: human HER2/ErbB2, Fc/His-Tag, Human
Biozol Catalog Number: TRZ-P2020-166_100
Supplier Catalog Number: P2020-166_100
Alternative Catalog Number: TRZ-P2020-166_100
Manufacturer: trenzyme
Host: Human
Category: Biochemikalien
Application: Kinase Assay, WB
Species Reactivity: Human
Alternative Names: ERBB2, Receptor tyrosine-protein kinase erbB-2, Metastatic lymph node gene 19 protein (MLN 19), Proto-oncogene Neu, NEU, NGL, Proto-oncogene c-ErbB-2, Tyrosine kinase-type cell surface receptor HER2, HER2, HER-2, p185erbB2, CD340
The human epidermal growth factor receptor 2 (HER2), which is also referred to as ErbB2 as it is encoded by the ERBB2 gene (erythroblastic oncogene B), is a receptor tyrosine kinase that belongs to the epidermal growth factor receptor (EGFR) family. The
Molecular Weight: 98,5 kDa
UniProt: P04626
Buffer: PBS
Purity: > 80 % as determined by SDS-PAGE
Form: liquid
Sequence: MSTQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNYALAVLDNGDPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSEDCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTY
Formula: pH 7,4