human APRIL, MBP/His-Tag, Human

Catalog Number: TRZ-P2020-167_1000
Article Name: human APRIL, MBP/His-Tag, Human
Biozol Catalog Number: TRZ-P2020-167_1000
Supplier Catalog Number: P2020-167_1000
Alternative Catalog Number: TRZ-P2020-167_1000
Manufacturer: trenzyme
Host: Human
Category: Biochemikalien
Application: FA
Species Reactivity: Human
Alternative Names: Tumor necrosis factor ligand superfamily member 13, TNFSF13, A proliferation-inducing ligand, TNF- and APOL-related leukocyte expressed ligand 2 (TALL-2), TALL2, TNF-related death ligand 1 (TRDL-1), CD256, ZTNF2
A proliferation-inducing ligand (APRIL), also referred to as tumor necrosis factor ligand superfamily member 13 (TNFSF13), belongs to the TNF superfamily of cytokines and is produced by various immune cells, including dendritic cells, monocytes, macropha
Molecular Weight: 59,8 kDa
UniProt: O75888
Buffer: PBS
Purity: > 70 % as determined by SDS-PAGE
Form: liquid
Sequence: MAVLTQKQKKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVY LLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGD ILSVIIPRARAKLNLSPHGTFLGFVKL
Formula: pH 7,4