hACE2(ECD) (A25V, K31N, E35K, L79F), Avi/His-Tag, Human

Product Overview

• Article Name: hACE2(ECD) (A25V, K31N, E35K, L79F), Avi/His-Tag, Human
• Biozol Catalog Number: TRZ-P2020-171_100
• Supplier Catalog Number: P2020-171_100
• Alternative Catalog Number: TRZ-P2020-171_100
• Manufacturer: trenzyme
• Host: Human
• Category: Biochemikalien
• Application: ELISA, FA
• Species Reactivity: Human
• Alternative Names: hACE2, ACEH, human angiotensin-converting enzyme 2, ACE-related carboxypeptidase, Angiotensin-converting enzyme homolog, Metalloprotease MPROT15, non-biotinylated hACE2

Product Description

The human Angiotensin-Converting Enzyme 2 (hACE-2) is a type I transmembrane metallocarboxypeptidase with homology to ACE, an regulator in the Renin-Angiotensin system (RAS) and long-known as a target for the treatment of hypertension. hACE2 is expressed

Product Properties

• Molecular Weight: 83,2 kDa
• UniProt: Q9BYF1
• Buffer: PBS
• Purity: > 95 % as determined by SDS-PAGE
• Form: liquid
• Sequence: MTIEEQVKTFLDNFNHKAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQST FAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNP QECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLYEEYVVLKNEMARANHYED YGDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLMNAYPSYISP IGCLPAHLLG
• Formula: pH 7,4