greenTEV Cleavage Kit, E. coli

Product Overview

• Article Name: greenTEV Cleavage Kit, E. coli
• Biozol Catalog Number: TRZ-P2020-CK1
• Supplier Catalog Number: P2020-CK1
• Alternative Catalog Number: TRZ-P2020-CK1
• Manufacturer: trenzyme
• Host: E. coli
• Category: Biochemikalien
• Alternative Names: TEV Protease, TEV, Tobacco Etch Virus nuclear-inclusion-a endopeptidase, rTEV, P1 protease, EC 3.4.22.44, control protein, reference protein, cleavage control protein, multiple tag control protein, universal reference protein

Product Description

Including: 1 x greenTEV (P2020-142) 1 x Cleavage and tag control protein (P2020-141) Performance of cleavage conditions can be easily controlled and visualized by SDS-PAGE using the Cleavage and tag control protein. TEV cleavage results in two cleavage p

Product Properties

• Molecular Weight: 53,7 kDa / 90,5 kDa
• UniProt: Q0GDU8
• Buffer: greenTEV: 50 mM Tris, 150 mM NaCl, 0.5 mM EDTA, 5% Trehalose, pH 8.0, Cleavage and tag control protein: PBS, pH 7.4
• Purity: > 85% as determined by SDS-PAGE
• Form: lyophilized
• Sequence: greenTEV: KGPRDYNPISSSICHLTNESDGHTTSLYGIGFGPFIITNKHLFRRNNGTLVVQSLHGVFK VKDTTTLQQHLVDGRDMIIIRMPKDFPPFPQKLKFREPQREERICLVTTNFQTKSMSSMV SDTSCTFPSGDGIFWKHWIQTKDGQCGSPLVSTRDGFIVGIHSASNFTNTNNYFTSVPKN FMELLTNQEAQQWVSGWRLNADSVLWGGHKVFMVKPEEPFQPVKEATQLMNE
• Formula: greenTEV: pH 8.0, Cleavage and tag control protein: pH 7.4

Images

Illustration of greenTEV Cleavage Kit

Structural model of Cleavage and tag control protein