Nerve Growth Factor (NGF), Recombinant, Equine, His-Tag

Catalog Number: USB-051717
Article Name: Nerve Growth Factor (NGF), Recombinant, Equine, His-Tag
Biozol Catalog Number: USB-051717
Supplier Catalog Number: 051717
Alternative Catalog Number: USB-051717-10,USB-051717-50,USB-051717-100,USB-051717-200
Manufacturer: US Biological
Category: Molekularbiologie
Application: WB
Recombinant protein corresponding to aa64-286 from equine Nerve Growth Factor, with a N-terminal His-Tag, expressed in E. coli. Uniprot/Accession: F6SVV7 Molecular Weight: ~26.6kD Predicted Isoelectric Point: 10.2 Predicted Molecular Weight: 26.6kD Accurate Molecular Weight: 32kD as determined by SDS-PAGE reducing conditions Phenomenon Explanation: The possible reasons that the actual band size differs from the predicted are as follows: 1. Splice variants: Alternative splicing may create different sized proteins from the same gene. 2. Relative charge: The composition of amino acids may affects the charge of the protein. 3. Post-translational modification: Phosphorylation, glycosylation, methylation etc. 4. Post-translation cleavage: Many proteins are synthesized as pro-proteins, and then cleaved to give the active form. 5. Polymerization of the target protein: Dimerization, multimerization etc. Subcellular Location: Secreted Amino Acid Sequence: EPHTESNVPAGHAIPQAHWTKLQHSLDTALRRARSAPARAIAAVAGQTRNITVDPKLFKKRRLRSPRVLFSTQPPPVAADTQDLDFEAGGAASFNRTHRSKRSSSHPVFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKTGRKA Applications: Suitable for use as a positive control, Immunogen, SDS-PAGE and Western Blot. Other applications not tested Recommended Dilutions: Optimal dilutions to be determined by the researcher. Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -70C. Reconstitute with sterile PBS. Aliquot to avoid repeated freezing and thawing. Store at -70C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. Note: Thermal stability is described by the loss rate of the target protein. The loss rate was determined by accelerated thermal degradation by incubating the protein at 37C for 48h, with no obvious degradation or precipitation observed. Protein loss is <5% within the expiration date under appropriate storage conditions.
Molecular Weight: 26.6
UniProt: F6SVV7
Purity: 90%
Form: Supplied as lyophilized powder from PBS, pH 7.4, 0.01% sarcosyl, 5% trehalose. Reconstitute with sterile PBS pH 7.4 to a concentration of 0.1-1mg/ml. Do not vortex.