Coagulation factor VIII (F8), Recombinant, Human, His-GST-Tag
Biozol Catalog Number:
USB-052072
Supplier Catalog Number:
052072
Alternative Catalog Number:
USB-052072-20,USB-052072-100
Manufacturer:
US Biological
Category:
Molekularbiologie
Human FVIII (F8) plays a crucial role in the blood coagulation cascade. It acts as a cofactor for the activation of factor X by factor IXa, thereby facilitating the formation of blood clots [1][2]. FVIII typically binds to the von Willebrand factor (vWF) in plasma, further enhancing its stability and function [3]. FVIII is a glycoprotein highly sensitive to proteolysis but is protected by forming a high-affinity complex with coagulation factor VIII-related antigen, which is subsequently released into the circulation [4]. It is vital for proper blood clotting [5]. FVIII constitutes only a small fraction of the proteins in plasma, typically ranging from 1 to 3 ppm [6]. Acquired hemophilia A, an autoimmune disease, can lead to life-threatening hemorrhagic disorders due to the presence of autoantibodies against FVIII [7][8]. Recombinant protein corresponding to aa1-216 from human Coagulation factor VIII (F8), fused to 6X His-GST-Tag at N-terminal, expressed in E. coli. Uniprot/Swiss Accession: P00451. Molecular Weight: ~56.2kD Amino Acid Sequence: MRIQDPGKVFFGNVDSSGIKHNIFNPPIIARYIRLHPTHYSIRSTLRMELMGCDLNSCSMPLGMESKAISDAQITASSYFTNMFATWSPSKARLHLQGRSNAWRPQVNNPKEWLQVDFQKTMKVTGVTTQGVKSLLTSMYVKEFLISSSQDGHQWTLFFQNGKVKVFQGNQDSFTPVVNSLDPPLLTRYLRIHPQSWVHQIALRMEVLGCEAQDLY Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
