Outer Membrane Protein A (OmpA), Recombinant, Rickettsia conorii, aa1734-2021, His-Tag, Myc-Tag

Product Overview

• Article Name: Outer Membrane Protein A (OmpA), Recombinant, Rickettsia conorii, aa1734-2021, His-Tag, Myc-Tag
• Biozol Catalog Number: USB-052483
• Supplier Catalog Number: 052483
• Alternative Catalog Number: USB-052483-20,USB-052483-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Patial recombinant protein corresponding to aa1734-2021 from Rickettsia conorii (strain ATCC VR-613/Malish 7) Outer Membrane Protein A, fused to N-terminal 10xHis-Tag and C-terminal Myc-Tag, expressed in E. coli. Swiss/Uniprot: Q52657 Molecular Weight: ~39.2kD Amino Acid Sequence: DMDAKFGAWISPFVGNATQKMCNSISGYKSDTTGGTIGFDGFVSDDLVLGLAYTRADTDIKLKNNKTGDKNKVESNIYSLYGLYSVPYENLFVEAIASYSDNKIRSKSRRVIATTLETVGYQTANGKYKSESYTGQLMAGYTYMMSENINLTPLAGLRYSTIKDKSYKETGTTYQNLTVKGKNYNTFDGLLGAKVSSNINVNEIVLTPELYAMVDYAFKNKVSAIDARLQGMTAPLPTNSFKQSKTSFDVGVGVTAKHKMMEYGINYDTNIGSKYFAQQGSVKVRVNF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 39.2
• UniProt: Q52657
• Purity: 85% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.