Full length recombinant protein corresponding to aa20-159 from Rickettsia typhi (strain ATCC VR-144 / Wilmington) 17 kDa Surface Antigen, fused to N-terminal 10xHis-Tag and C-terminal Myc-Tag, expressed in E. coli. Swiss/Uniprot: P22882 Molecular Weight: ~22kD Amino Acid Sequence: CNGPGGMNKQGTGTLLGGAGGALLGSQFGHGKGQLVGVGVGALLGAVLGGQIGASMDEQDRKLLELTSQRALESAPSGSNIEWRNPDNGNHGYVTPNKTYRNSTGQYCREYTQTVVIGGKQQTTYGNACRQPDGQWQVAN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted