Outer Membrane Protein B (ompB), Recombinant, Rickettsia conorii, aa1335-1655, His-Avi-Tag

Product Overview

• Article Name: Outer Membrane Protein B (ompB), Recombinant, Rickettsia conorii, aa1335-1655, His-Avi-Tag
• Biozol Catalog Number: USB-052487
• Supplier Catalog Number: 052487
• Alternative Catalog Number: USB-052487-20,USB-052487-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

The 120 kDa surface-exposed protein is a major structural protein which may play a role as a rickettsial virulence factor and/or immunogen during infection. The 32 kDa beta peptide may serve as a membrane anchor. It has been shown to adhere to biotinylated Vero cell proteins. Partial recombinant protein corresponding to aa1335-1655 from Rickettsia conorii (strain ATCC VR-613 /Malish 7) Outer Membrane Protein B, fused to C-terminal 6xHis-Avi-Tag, expressed in E. coli. Swiss/Uniprot: Q9KKA3 Molecular Weight: ~43.8kD Amino Acid Sequence: GALRYLGTPETAEMAGPEAGAIPAAVAAGDEAVDNVAYGIWAKPFYTDAHQSKKGGLAGYKAKTTGVVIGLDTLANDNLMIGAAIGITKTDIKHQDYKKGDKTDVNGFSFSLYGAQQLVKNFFAQGSAIFSLNQVKNKSQRYFFDANGNMSKQIAAGHYDNMTFGGNLTVGYDYNAMQGVLVTPMAGLSYLKSSDENYKETGTTVANKQVNSKFSDRTDLIVGAKVAGSTMNITDLAVYPEVHAFVVHKVTGRLSKTQSVLDGQVTPCISQPDRTAKTSYNLGLSASIRSDAKMEYGIGYDAQISSKYTAHQGTLKVRVNF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 43.8
• UniProt: Q9KKA3
• Purity: 85% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.