Protein E7, Recombinant, Human Papillomavirus Type 16, aa1-98, His-Tag, Active
Biozol Catalog Number:
USB-059357
Supplier Catalog Number:
059357
Alternative Catalog Number:
USB-059357-20,USB-059357-100,USB-059357-1
Manufacturer:
US Biological
Category:
Molekularbiologie
Plays a role in viral genome replication by driving entry of quiescent cells into the cell cycle. Stimulation of progression from G1 to S phase allows the virus to efficiently use the cellular DNA replicating machinery to achieve viral genome replication. E7 protein has both transforming and trans-activating activities. Induces the disassembly of the E2F1 transcription factor from RB1, with subsequent transcriptional activation of E2F1-regulated S-phase genes. Interferes with host histone deacetylation mediated by HDAC1 and HDAC2, leading to transcription activation. Plays also a role in the inhibition of both antiviral and antiproliferative functions of host interferon alpha. Interaction with host TMEM173/STING impairs the ability of TMEM173/STING to sense cytosolic DNA and promote the production of type I interferon (IFN-alpha and IFN-beta). Full length recombinant protein corresponding to aa1-98 from Human papillomavirus type 16 Protein E7, fused to 6X His-Tags at N-terminal and C-terminal, expressed in E.coli. Swiss/Uniprot Accession: P03129 Molecular Weight: ~16.3kD Amino Acid Sequence: MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP Biological Activity: The EC50 as measured by its binding ability in a functional ELISA is 268.1-354.3ng/ml. Immobilized HPV16 E7 at 10ug/ml can bind biotinylated MYC. Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, pH 8.0, 0.5M sodium chloride, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted