Troponins form a complex of three regulatory proteins (troponin C, I and T) that are integral to muscle contraction in skeletal and cardiac muscles. Serum cardiac troponin tests can be used to help diagnose several different heart disorders, especially myocardial infarction. Recombinant protein corresponding to human Cardiac troponin I, fused to His-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~26kD Amino Acid Sequence: MADGSSDAAREPRPAPAPIRRRSSNYRAYATEPHAKKKSKISASRKLQLK TLLLQIAKQELEREAEERRGEKGRALSTRCQPLELAGLGFAELQDLCRQL HARVDKVDEERYDIEAKVTKNITEIADLTQKIFDLRGKFKRPTLRRVRISAD AMMQALLGARAKESLDLRAHLKQVKKEDMEKENREVGDWRKNIDALSG MEGRKKKFESESSGGGSLEHHHHHHHH Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight:
26
Purity:
Capillary electrophoresis (CE-SDS)
Form:
Supplied as a lyophilized powder from 50mM Tris-HCl, pH 7.5, 150mM sodium chloride, 8M urea. Contains 3% sucrose, 2% D-mannitol, and 0.01% Tween 20 as stabilizers. Reconstitute with sterile ddH2O.
* VAT and and shipping costs not included. Errors and price changes excepted