AHSP (Alpha-hemoglobin-stabilizing Protein, EDRF, ERAF, Erythroid Associated Factor, Erythroid Differentiation-related Factor) (PE), Clone: [2E4], Mouse, Monoclonal

Catalog Number: USB-123100-PE
Article Name: AHSP (Alpha-hemoglobin-stabilizing Protein, EDRF, ERAF, Erythroid Associated Factor, Erythroid Differentiation-related Factor) (PE), Clone: [2E4], Mouse, Monoclonal
Biozol Catalog Number: USB-123100-PE
Supplier Catalog Number: 123100-PE
Alternative Catalog Number: USB-123100-PE-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: FLISA, WB
Immunogen: Full length recombinant corresponding to aa1-102 from human AHSP with GST tag. MW of the GST tag alone is 26kD.
AHSP (Alpha-hemoglobin stabilizing protein), also known as ERAF (Erythroid associated factor), is an erythroid-specific protein that acts as a chaperone to prevent the aggregation of aplha-hemoglobin during normal erythroid cell development. It specifically protects free alpha-hemoglobin from precipitation in live cells and in solution. This protein is downregulated in transmissible spongiform encephalopathies (TSEs). It is predicted to modulate pathological states of alpha-hemoglobin excess such as beta-thalassemia. Recombinant AHSP protein, expressed in E. coli and purified by using conventional chromatography techniques. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MALLKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKSHELPSHPPPSS Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
Clonality: Monoclonal
Clone Designation: [2E4]
NCBI: 016633
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).