BAZ1B (WBSC10, WBSCR10, WBSCR9, WSTF, Tyrosine-protein Kinase BAZ1B, Bromodomain Adjacent to Zinc Finger Domain Protein 1B, Williams Syndrome Transcription Factor, Williams-Beuren Syndrome Chromosomal Region 10 Protein, Williams-B

Catalog Number: USB-123844-HRP
Article Name: BAZ1B (WBSC10, WBSCR10, WBSCR9, WSTF, Tyrosine-protein Kinase BAZ1B, Bromodomain Adjacent to Zinc Finger Domain Protein 1B, Williams Syndrome Transcription Factor, Williams-Beuren Syndrome Chromosomal Region 10 Protein, Williams-B
Biozol Catalog Number: USB-123844-HRP
Supplier Catalog Number: 123844-HRP
Alternative Catalog Number: USB-123844-HRP-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: ELISA, IHC
Immunogen: Partial recombinant corresponding to aa1384-1484 from BAZ1B (NP_075381) with GST tag. MW of the GST tag alone is 26kD.
This gene encodes a member of the bromodomain protein family. The bromodomain is a structural motif characteristic of proteins involved in chromatin-dependent regulation of transcription. This gene is deleted in Williams-Beuren syndrome, a developmental disorder caused by deletion of multiple genes at 7q11.23. Applications: Suitable for use in ELISA and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MDFQTVQNKCSCGSYRSVQEFLTDMKQVFTNAEVYNCRGSHVLSCMVKTEQCLVALLHKHLPGHPYVRRKRKKFPDRLAEDEGDSEPEAVGQSRGRRQKK Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Clonality: Monoclonal
Clone Designation: [5E9]
NCBI: 023005
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).