BCL2L2 (Bcl-2-like Protein 2, Bcl2-L-2, Apoptosis Regulator Bcl-W, BCLW, KIAA0271), Mouse

Catalog Number: USB-123890
Article Name: BCL2L2 (Bcl-2-like Protein 2, Bcl2-L-2, Apoptosis Regulator Bcl-W, BCLW, KIAA0271), Mouse
Biozol Catalog Number: USB-123890
Supplier Catalog Number: 123890
Alternative Catalog Number: USB-123890-50
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: WB
Immunogen: Full length human BCL2L2, aa1-193 (NP_004041.1).
Bcl-w is a pro-survival (apoptotic) member of the Bcl-2 family, a family involved in the regulation of cellular apoptosis at the mitochondrion. Relative to its Bcl-2 counterparts there is considerably less data on this prticular protein. Studies of the related gene in mice indicated a role in the survival of NGF- and BDNF-dependent neurons. Mutation and knockout studies of the mouse gene demonstrated an essential role in adult spermatogenesis. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
NCBI: 004050
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2.