CASP1 (Caspase-1, CASP-1, Interleukin-1 beta Convertase, IL-1BC, Interleukin-1 beta-Converting Enzyme, IL-1 beta-converting Enzyme, ICE, p45, Caspase-1 Subunit p20, Caspase-1 Subunit p10, IL1BCE, IL1BC, CASP1), Clone: [3D2], Mouse

Catalog Number: USB-124352
Article Name: CASP1 (Caspase-1, CASP-1, Interleukin-1 beta Convertase, IL-1BC, Interleukin-1 beta-Converting Enzyme, IL-1 beta-converting Enzyme, ICE, p45, Caspase-1 Subunit p20, Caspase-1 Subunit p10, IL1BCE, IL1BC, CASP1), Clone: [3D2], Mouse
Biozol Catalog Number: USB-124352
Supplier Catalog Number: 124352
Alternative Catalog Number: USB-124352-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: ELISA, IHC, WB
Immunogen: Partial recombinant corresponding to aa1-100 from human CASP1 (AAH62327) with GST tag. MW of the GST tag alone is 26kD.
CASP1 is a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce 2 subunits, large and small, that dimerize to form the active enzyme. CASP1 was identified by its ability to proteolytically cleave and activate the inactive precursor of interleukin-1, a cytokine involved in the processes such as inflammation, septic shock, and wound healing. This protein has been shown to induce cell apoptosis and may function in various developmental stages. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MADKVLKEKRKLFIRSMGEAPQAVQDNPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLL Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Clonality: Monoclonal
Clone Designation: [3D2]
NCBI: 062327
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2.