CK-BB (CKBB, Creatine Kinase B-type, B-CK, Creatine Kinase B Chain, CKB) (APC), Clone: [3D5-3D11], Mouse, Monoclonal

Catalog Number: USB-125015-APC
Article Name: CK-BB (CKBB, Creatine Kinase B-type, B-CK, Creatine Kinase B Chain, CKB) (APC), Clone: [3D5-3D11], Mouse, Monoclonal
Biozol Catalog Number: USB-125015-APC
Supplier Catalog Number: 125015-APC
Alternative Catalog Number: USB-125015-APC-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: FLISA, IF, WB
Immunogen: Full length recombinant corresponding to aa1-381 from human CKB (AAH01190) with GST tag. MW of the GST tag alone is 26kD.
Creatine Kinase (CK) is a dimeric enzyme composed of either M- or B-type subunits. The resulting isoenzymes are expressed at varying levels in different tissues. CK-BB, a cytoplasmic predominantly found in brain tissues, participates in energy homeostasis, reversibly catalyzing the transfer of a phosphate group between ATP and target proteins such as a creatine phosphate. CK-BB exists in normally neglible amounts in the serum of adults, overexpression of CK-BB is associated with cancers of the breast, ovary, prostate, colon, and in small-cell lung cancer. Global assessment of changes in serum levels of CK-BB, CK-MB and CK-MM, are used as a marker for myocardial infarction. Applications: Suitable for use in Immunofluorescence, FLISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 30ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
Clonality: Monoclonal
Clone Designation: [3D5-3D11]
NCBI: 001190
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).