CTTN (Src Substrate Cortactin, , Amplaxin, Oncogene EMS1, FLJ34459) (PE), Clone: [2B5], Mouse, Monoclonal

Catalog Number: USB-125477-PE
Article Name: CTTN (Src Substrate Cortactin, , Amplaxin, Oncogene EMS1, FLJ34459) (PE), Clone: [2B5], Mouse, Monoclonal
Biozol Catalog Number: USB-125477-PE
Supplier Catalog Number: 125477-PE
Alternative Catalog Number: USB-125477-PE-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: FLISA, WB
Immunogen: Partial recombinant corresponding to aa341-450 from human CTTN (NP_005222.2) with GST tag. MW of the GST tag alone is 26kD.
Contributes to the organization of the actin cytoskeleton and cell structure. Plays a role in the regulation of cell migration. Plays a role in the invasiveness of cancer cells, and the formation of metastases. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: EAVTSKTSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVYEDAASFKAELSYRGPVSGTEPEPVYSMEA Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
Clonality: Monoclonal
Clone Designation: [2B5]
NCBI: 005231
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).