DAG1 (Dystroglycan, Dystrophin-associated Glycoprotein 1, Alpha-dystroglycan, alpha-DG) (PE), Clone: [2A3], Mouse, Monoclonal

Catalog Number: USB-125621-PE
Article Name: DAG1 (Dystroglycan, Dystrophin-associated Glycoprotein 1, Alpha-dystroglycan, alpha-DG) (PE), Clone: [2A3], Mouse, Monoclonal
Biozol Catalog Number: USB-125621-PE
Supplier Catalog Number: 125621-PE
Alternative Catalog Number: USB-125621-PE-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: FLISA, WB
Immunogen: Partial recombinant corresponding to aa31-140 from human DAG1 (AAH12740) with GST tag. MW of the GST tag alone is 26kD.
The dystroglycan complex is involved in a number of processes including laminin and basement membrane assembly, sarcolemmal stability, cell survival, peripheral nerve myelination, nodal structure, cell migration, and epithelial polarization. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: WPSEPSEAVRDWENQLEASMHSVLSDLHEAVPTVVGIPDGTAVVGRSFRVTIPTDLIASSGDIIKVSAAGKEALPSWLHWDSQSHTLEGLPLDTDKGVHYISVSATRLGA Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
Clonality: Monoclonal
Clone Designation: [2A3]
NCBI: 012740
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).