DUSP9 (Dual Specificity Protein Phosphatase 9, Mitogen-activated Protein Kinase Phosphatase 4, MAP Kinase Phosphatase 4, MKP-4, MKP4) (FITC), Clone: [2E3], Mouse, Monoclonal

Catalog Number: USB-126076-FITC
Article Name: DUSP9 (Dual Specificity Protein Phosphatase 9, Mitogen-activated Protein Kinase Phosphatase 4, MAP Kinase Phosphatase 4, MKP-4, MKP4) (FITC), Clone: [2E3], Mouse, Monoclonal
Biozol Catalog Number: USB-126076-FITC
Supplier Catalog Number: 126076-FITC
Alternative Catalog Number: USB-126076-FITC-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: FLISA, WB
Immunogen: Partial recombinant corresponding to aa174-278 from human DUSP9 (NP_001386) with GST tag. MW of the GST tag alone is 26kD.
DUSP9 is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which is associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. This DUSP9 shows selectivity for members of the ERK family of MAP kinases, is expressed only in placenta, kidney, and fetal liver, and is localized to the cytoplasm and nucleus. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: AESEADRDSMSCGLDSEGATPPPVGLRASFPVQILPNLYLGSARDSANLESLAKLGIRYILNVTPNLPNFFEKNGDFHYKQIPISDHWSQNLSRFFPEAIEFIDE Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Clonality: Monoclonal
Clone Designation: [2E3]
NCBI: 001395
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).