EIF4E2 (EIF4EL3, Eukaryotic Translation Initiation Factor 4E Type 2, Eukaryotic Translation Initiation Factor 4E Homologous Protein, Eukaryotic Translation Initiation Factor 4E-like 3, eIF4E-like Protein 4E-LP, mRNA Cap-binding Pr

Catalog Number: USB-126239-ML650
Article Name: EIF4E2 (EIF4EL3, Eukaryotic Translation Initiation Factor 4E Type 2, Eukaryotic Translation Initiation Factor 4E Homologous Protein, Eukaryotic Translation Initiation Factor 4E-like 3, eIF4E-like Protein 4E-LP, mRNA Cap-binding Pr
Biozol Catalog Number: USB-126239-ML650
Supplier Catalog Number: 126239-ML650
Alternative Catalog Number: USB-126239-ML650-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: FLISA, IF, IHC, WB
Immunogen: Full length recombinant corresponding to aa1-245 from EIF4E2 (AAH05392) with GST tag. MW of the GST tag alone is 26kD.
MaxLight(TM)650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor(TM)647, DyLight(TM)649, Cy5(TM) and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm), Emission (676nm), Extinction Coefficient 250,000. EIF4E2 is expressed exclusively in the cytoplasm. This protein recognizes and binds the 7 methylguanosine containing mRNA cap during an early step in the initiation of protein synthesis and facilitates ribosome binding by inducing the unwinding of the mRNAs secondary structures. Applications: Suitable for use in FLISA, Immunohistochemistry, Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQYNYTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKMPGRLGPQRLLFQNLWKPRLNVP Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight(TM)650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
Clonality: Monoclonal
Clone Designation: [4G10]
NCBI: 005392
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight(TM)650.