ELK1 (ETS Domain-containing Protein Elk-1) (PE), Clone: [2G6], Mouse, Monoclonal

Catalog Number: USB-126282-PE
Article Name: ELK1 (ETS Domain-containing Protein Elk-1) (PE), Clone: [2G6], Mouse, Monoclonal
Biozol Catalog Number: USB-126282-PE
Supplier Catalog Number: 126282-PE
Alternative Catalog Number: USB-126282-PE-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: FLISA
Immunogen: Partial recombinant corresponding to aa67-166 from human ELK1 (NP_005220) with GST tag. MW of the GST tag alone is 26kD.
Elk-1 is a transcription factor that binds the serum response element (SRE) and mediates gene activity in response to serum and growth factors. Elk-1 is phosphorylated by MAP kinase pathways and appears to be a direct target of activated MAP kinase. Biochemical studies indicate that Elk-1 is a good substrate for MAP kinase. The kinetics of Elk-1 phosphorylation and activation correlate with MAP kinase activity. Other studies have shown that Elk-1 (Ser383) is also a target of the stress-activated kinase SAPK/JNK. Applications: Suitable for use in FLISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: YYDKNIIRKVSGQKFVYKFVSYPEVAGCSTEDCPPQPEVSVTSTMPNVAPAAIHAAPGDTVSGKPGTPKGAGMAGPGGLARSSRNEYMRSGLYSTFTIQS Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
Clonality: Monoclonal
Clone Designation: [2G6]
NCBI: 005229
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).