F1AA (FEM1B, Protein Fem-1 Homolog B, FEM1b, FEM1-beta, Fem-1-like Death Receptor-binding Protein alpha, Fem-1-like in Apoptotic Pathway Protein alpha, F1A-alpha, KIAA0396), Clone: [4B12], Mouse, Monoclonal

Catalog Number: USB-126538
Article Name: F1AA (FEM1B, Protein Fem-1 Homolog B, FEM1b, FEM1-beta, Fem-1-like Death Receptor-binding Protein alpha, Fem-1-like in Apoptotic Pathway Protein alpha, F1A-alpha, KIAA0396), Clone: [4B12], Mouse, Monoclonal
Biozol Catalog Number: USB-126538
Supplier Catalog Number: 126538
Alternative Catalog Number: USB-126538-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: ELISA
Immunogen: Partial recombinant corresponding to aa401-490 from FEM1B (NP_056137) with GST tag. MW of the GST tag alone is 26kD.
FEM1B is involved in apoptosis by acting as a death receptor-associated protein that mediates apoptosis, it is involved in glucose homeostasis in pancreatic islet. FEM1B is widely expressed, highest expression being found within the testis while more weakly expressed in other tissues. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: TVKAPDIECVLRCSVLEIEQSMNRVKNISDADVHNAMDNYECNLYTFLYLVCISTKTQCSEEDQCKINKQIYNLIHLDPRTREGFTLLHL Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Clonality: Monoclonal
Clone Designation: [4B12]
NCBI: 015322
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2.