F1AA (FEM1B, Protein Fem-1 Homolog B, FEM1b, FEM1-beta, Fem-1-like Death Receptor-binding Protein alpha, Fem-1-like in Apoptotic Pathway Protein alpha, F1A-alpha, KIAA0396) (MaxLight 650), Clone: [4B12], Mouse, Monoclonal
Biozol Catalog Number:
USB-126538-ML650
Supplier Catalog Number:
126538-ML650
Alternative Catalog Number:
USB-126538-ML650-100
Manufacturer:
US Biological
Host:
Mouse
Category:
Antikörper
Application:
FLISA
Immunogen:
Partial recombinant corresponding to aa401-490 from FEM1B (NP_056137) with GST tag. MW of the GST tag alone is 26kD.
MaxLight(TM)650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor(TM)647, DyLight(TM)649, Cy5(TM) and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm), Emission (676nm), Extinction Coefficient 250,000. FEM1B is involved in apoptosis by acting as a death receptor-associated protein that mediates apoptosis, it is involved in glucose homeostasis in pancreatic islet. FEM1B is widely expressed, highest expression being found within the testis while more weakly expressed in other tissues. Applications: Suitable for use in FLISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: TVKAPDIECVLRCSVLEIEQSMNRVKNISDADVHNAMDNYECNLYTFLYLVCISTKTQCSEEDQCKINKQIYNLIHLDPRTREGFTLLHL Storage and Stability: Store product at 4C in the dark. DO NOT FREEZE! Stable at 4C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight(TM)650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
