F9 (Coagulation Factor IX, Christmas Factor, Plasma Thromboplastin Component, PTC) (HRP), Clone: [2C9], Mouse, Monoclonal

Catalog Number: USB-126543-HRP
Article Name: F9 (Coagulation Factor IX, Christmas Factor, Plasma Thromboplastin Component, PTC) (HRP), Clone: [2C9], Mouse, Monoclonal
Biozol Catalog Number: USB-126543-HRP
Supplier Catalog Number: 126543-HRP
Alternative Catalog Number: USB-126543-HRP-100
Manufacturer: US Biological
Host: Mouse
Category: Antikörper
Application: ELISA, IP, WB
Immunogen: Partial recombinant protein corresponding to aa96-190 from human F9 with GST tag. MW of the GST tag alone is 26kD.
Coagulation Factor IX (F9) circulates in the blood as an inactive zymogen. This factor is converted to an active form by factor XIa, which excises the activation peptide and thus generates a heavy chain and a light chain held together by one or more disulfide bonds. The role of this activated factor IX in the blood coagulation cascade is to activate factor X to its active form through interactions with Ca+2 ions, membrane phospholipids, and factor VIII. Alterations of this gene, including point mutations, insertions and deletions, cause factor IX deficiency, which is a recessive X-linked disorder, also called hemophilia B or Christmas disease. Applications: Suitable for use in ELISA, Western Blot and Immunoprecipitation. Other applications have not been tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amio Acid Sequence: QCESNPCLNGGSCKDDINSYECWCPFGFEGKNCELDVTCNIKNGRCEQFCKNSADNKVVCSCTEGYRLAENQKSCEPAVPFPCGRVSVSQTSKLT Storage and Stability: Store product at 4C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20C. Aliquots are stable at -20C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
Clonality: Monoclonal
Clone Designation: [2C9]
NCBI: 000133
Purity: Purified by Protein A affinity chromatography.
Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish peroxidase (HRP).